SMART: PDB domain 3a1b

The domain within your query sequence starts at position 454 and ends at position 610; the E-value for the 3a1b domain shown below is 2e-99.

RKSTTEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFIGGMCQNC
KNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIK
EDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHD

The domain within your query sequence starts at position 454 and ends at position 610; the E-value for the 3a1b domain shown below is 2e-99.

This is a PDB domain - please see the PDBSUM entry of 3a1b for further annotation